AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF395 Antibody
상품 한눈에 보기
인간 ZNF395 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, 프레스티 항원으로 친화 정제되었습니다. 인간에 대한 검증된 반응성과 높은 종간 서열 유사성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076275-100 Anti-ZNF395 Antibody, zinc finger protein 395 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076275-25 Anti-ZNF395 Antibody, zinc finger protein 395 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF395 Antibody
Anti-ZNF395 Antibody
Target Information
- Target Protein: Zinc finger protein 395
- Target Gene: ZNF395
- Alternative Gene Names: DKFZp434K1210, HDBP2, PBF, PRF-1
Product Description
Polyclonal antibody against human ZNF395.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000034522 | 92% |
| Rat | ENSRNOG00000014191 | 88% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Handling Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.