
Atlas Antibodies Anti-ZNF280B Antibody
인간 ZNF280B 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, 토끼에서 생산된 IgG 형 항체입니다. PrEST 항원을 이용해 친화 정제되어 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되었으며, glycerol/PBS 버퍼에 보존됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF280B Antibody
Target Protein: Zinc finger protein 280B
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ZNF280B.
Alternative Gene Names
5`OY11.1, SUHW2, ZNF279, ZNF632
Antigen Information
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
DSPIIIEPLSKPDYRNSSPQVVPNNSSELPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGII
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000049764 | 51% |
| Rat | ENSRNOG00000052545 | 47% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF285 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF281 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF280B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF275 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF277 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|