
Atlas Antibodies Anti-ZNF276 Antibody
상품 한눈에 보기
Human ZNF276 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 대해 검증되었습니다. 40% glycerol과 PBS buffer로 안정화되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF276 Antibody
Target Protein: Zinc finger protein 276
Gene Symbol: ZNF276
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ZNF276.
Alternative Gene Names
CENP-Z, CENPZ, MGC45417, ZADT, ZFP276, ZNF477
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIY
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016631 | 89% |
| Mouse | ENSMUSG00000001065 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF280D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF280A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF276 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF276 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF260 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.