Thermo Fisher Scientific DLX5 Monoclonal Antibody (4H6)
DLX5 단백질을 표적으로 하는 Thermo Fisher Scientific의 Mouse Monoclonal Antibody (Clone 4H6). 인간 시료에 반응하며 ICC/IF 및 ELISA에 사용 가능. Affinity chromatography로 정제된 액상 형태이며, PBS buffer에 보존제 없이 저장. 연구용으로만 사용.
- 카탈로그번호
- H00001749-M07
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific DLX5 Monoclonal Antibody (4H6)
Applications
| Application | Tested Dilution |
|---|---|
| Immunocytochemistry (ICC/IF) | 10 µg/mL |
| ELISA | 0.3 ng/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2a, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 4H6 |
| Immunogen | DLX5 (NP_005212, 1–110 a.a) partial recombinant protein with GST tag. MW of GST tag alone is 26 kDa. |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*
Target Information
This gene encodes a member of a homeobox transcription factor gene family similar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.