Thermo Fisher Scientific DLX5 Monoclonal Antibody (4H6)
DLX5 단백질을 표적으로 하는 Thermo Fisher Scientific의 Mouse Monoclonal Antibody (Clone 4H6). 인간 시료에 반응하며 ICC/IF 및 ELISA에 사용 가능. Affinity chromatography로 정제된 액상 형태이며, PBS buffer에 보존제 없이 저장. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Immunocytochemistry (ICC/IF) | 10 µg/mL |
| ELISA | 0.3 ng/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2a, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 4H6 |
| Immunogen | DLX5 (NP_005212, 1–110 a.a) partial recombinant protein with GST tag. MW of GST tag alone is 26 kDa. |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*
Target Information
This gene encodes a member of a homeobox transcription factor gene family similar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific DLX5 Monoclonal Antibody (4C6)
518,100원
Thermo Fisher Scientific
Thermo Fisher Scientific DLX6 Monoclonal Antibody (2D7)
518,100원
Thermo Fisher Scientific
Thermo Fisher Scientific DLX5 Monoclonal Antibody (4H6)
518,100원
Thermo Fisher Scientific
Thermo Fisher Scientific DLX5 Monoclonal Antibody (4B7)
518,100원
Thermo Fisher Scientific
Thermo Fisher Scientific DLX5 Monoclonal Antibody (3F5)
518,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|