
Atlas Antibodies Anti-ZNF174 Antibody
상품 한눈에 보기
Human ZNF174 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. Recombinant expression으로 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 시료에 반응하며, 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF174 Antibody
Target: zinc finger protein 174 (ZNF174)
Type: Polyclonal Antibody against Human ZNF174
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human ZNF174.
Validated for use in multiple applications with recombinant expression confirmation.
Alternative Gene Names
- ZSCAN8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 174 |
| Target Gene | ZNF174 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007655 (79%), Mouse ENSMUSG00000054939 (79%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQ |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF148 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMYM6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF174 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF205 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.