
Atlas Antibodies Anti-ZNF19 Antibody
상품 한눈에 보기
Human ZNF19 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 40% 글리세롤/PBS 완충액에 보존됩니다. Human에 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF19 Antibody
Target: zinc finger protein 19 (ZNF19)
Type: Polyclonal Antibody against Human ZNF19
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human ZNF19 (zinc finger protein 19).
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
KOX12, MGC51021
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 19 |
| Target Gene | ZNF19 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000100235 (36%), Rat ENSRNOG00000016186 (34%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF205 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF200 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF200 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF20 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.