CacheBy
Atlas Antibodies Anti-ZFPL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZFPL1 Antibody

상품 한눈에 보기

인간 ZFPL1 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에서 검증됨. 독립 항체 비교 및 siRNA knockdown을 통한 유효성 확인. Rabbit 호스트, IgG 아이소타입, PrEST 항원으로 친화 정제. Human 반응성 확인 및 높은 종간 보존성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014909-100 Anti-ZFPL1 Antibody, zinc finger protein-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014909-25 Anti-ZFPL1 Antibody, zinc finger protein-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZFPL1 Antibody

Anti-ZFPL1 Antibody

Target: zinc finger protein-like 1 (ZFPL1)
Type: Polyclonal Antibody against Human ZFPL1
Supplier: Atlas Antibodies


  • IHC (Independent Validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Genetic Validation)
    Genetic validation in WB by siRNA knockdown.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against human ZFPL1.


Alternative Gene Names

D11S750, MCG4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger protein-like 1
Target Gene ZFPL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024792 (83%), Rat ENSRNOG00000050180 (83%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKR

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.