Atlas Antibodies Anti-ZFPL1 Antibody
상품 한눈에 보기
인간 ZFPL1 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에서 검증됨. 독립 항체 비교 및 siRNA knockdown을 통한 유효성 확인. Rabbit 호스트, IgG 아이소타입, PrEST 항원으로 친화 정제. Human 반응성 확인 및 높은 종간 보존성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZFPL1 Antibody
Target: zinc finger protein-like 1 (ZFPL1)
Type: Polyclonal Antibody against Human ZFPL1
Supplier: Atlas Antibodies
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Genetic Validation)
Genetic validation in WB by siRNA knockdown.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human ZFPL1.
Alternative Gene Names
D11S750, MCG4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein-like 1 |
| Target Gene | ZFPL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024792 (83%), Rat ENSRNOG00000050180 (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.