Atlas Antibodies Anti-ZDHHC16 Antibody

상품 한눈에 보기

인간 ZDHHC16 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC 응용에 적합하며, 독립 항체 비교를 통한 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040214-100 Anti-ZDHHC16 Antibody, zinc finger, DHHC-type containing 16 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040214-25 Anti-ZDHHC16 Antibody, zinc finger, DHHC-type containing 16 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger, DHHC-type containing 16
Supplier: Atlas Antibodies

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human ZDHHC16

항목	내용
Target Protein	zinc finger, DHHC-type containing 16
Target Gene	ZDHHC16
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)