
Atlas Antibodies Anti-ZDHHC16 Antibody
상품 한눈에 보기
인간 ZDHHC16 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC 응용에 적합하며, 독립 항체 비교를 통한 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 높은 특이성과 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZDHHC16 Antibody
Target: zinc finger, DHHC-type containing 16
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ZDHHC16
Alternative Gene Names
- APH2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, DHHC-type containing 16 |
| Target Gene | ZDHHC16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000025157 (99%)
- Rat ENSRNOG00000046530 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZDHHC17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZDHHC16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZDHHC16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZDHHC14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZDHHC15 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.