
원본
Atlas Antibodies Anti-ZDHHC16 Antibody
상품 한눈에 보기
인간 ZDHHC16 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC 응용에 적합하며, 독립 항체 비교를 통한 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040214-100 Anti-ZDHHC16 Antibody, zinc finger, DHHC-type containing 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040214-25 Anti-ZDHHC16 Antibody, zinc finger, DHHC-type containing 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZDHHC16 Antibody
Anti-ZDHHC16 Antibody
Target: zinc finger, DHHC-type containing 16
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ZDHHC16
Alternative Gene Names
- APH2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, DHHC-type containing 16 |
| Target Gene | ZDHHC16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000025157 (99%)
- Rat ENSRNOG00000046530 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



