
Atlas Antibodies Anti-ZC3H13 Antibody
인간 ZC3H13 단백질을 인식하는 폴리클로날 항체입니다. 토끼 유래 IgG로 제작되었으며, Affinity purification을 통해 높은 특이성과 순도를 보장합니다. IHC 등 다양한 연구 응용에 적합합니다. PBS/glycerol buffer에 보존되어 안정적입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZC3H13 Antibody
Target: Zinc finger CCCH-type containing 13
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal Antibody against Human ZC3H13
Alternative Gene Names
DKFZp434D1812, KIAA0853
Target Information
- Target Protein: Zinc finger CCCH-type containing 13
- Target Gene: ZC3H13
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
AVMLRVGISKKLAGSELFAKVKETCQRLLEKPKDADNLFEHELGALNMAALLRKEERASLLSNLGPCCKALCFRRDSAIRKQLVKNEKGTIKQAYTSAPMVDNELLRLSLRLFKR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000011237 | 92% |
| Mouse | ENSMUSG00000022000 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZC3H14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZC3H13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZC3H13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZC3H12A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZC3H12C Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|