
Atlas Antibodies Anti-YIPF5 Antibody
상품 한눈에 보기
Human YIPF5 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용 응용에 적합. FinGER5, SMAP-5 유전자 대체명과 교차 반응성 정보 제공. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-YIPF5 Antibody
Target Information
- Target Protein: Yip1 domain family, member 5
- Target Gene: YIPF5
- Alternative Gene Names: FinGER5, SMAP-5
Product Description
Polyclonal antibody against human YIPF5.
Recommended Applications
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
NLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLE
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000024487): 88%
- Rat (ENSRNOG00000014564): 85%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-YIPF4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-YIPF6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-YIPF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-YIPF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-YIPF3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.