
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IL13RA2 Antibody
상품 한눈에 보기
Human IL13RA2 단백질을 인식하는 토끼 폴리클로날 항체로, interleukin 13 receptor subunit alpha 2를 타깃으로 함. 다양한 응용 분야에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증된 고품질 연구용 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045831-100 Anti-IL13RA2 Antibody, interleukin 13 receptor subunit alpha 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045831-25 Anti-IL13RA2 Antibody, interleukin 13 receptor subunit alpha 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IL13RA2 Antibody
Anti-IL13RA2 Antibody
Target: interleukin 13 receptor subunit alpha 2 (IL13RA2)
Type: Polyclonal Antibody against Human IL13RA2
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human IL13RA2.
Validated for use in human samples.
Alternative Gene Names
CD213a2, CT19, IL-13R, IL13BP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | interleukin 13 receptor subunit alpha 2 |
| Target Gene | IL13RA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000032973 (74%), Mouse ENSMUSG00000031289 (73%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



