CacheBy
Atlas Antibodies Anti-IL13RA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL13RA2 Antibody

상품 한눈에 보기

Human IL13RA2 단백질을 인식하는 토끼 폴리클로날 항체로, interleukin 13 receptor subunit alpha 2를 타깃으로 함. 다양한 응용 분야에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045831-100 Anti-IL13RA2 Antibody, interleukin 13 receptor subunit alpha 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045831-25 Anti-IL13RA2 Antibody, interleukin 13 receptor subunit alpha 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL13RA2 Antibody

Anti-IL13RA2 Antibody

Target: interleukin 13 receptor subunit alpha 2 (IL13RA2)
Type: Polyclonal Antibody against Human IL13RA2


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human IL13RA2.
Validated for use in human samples.


Alternative Gene Names

CD213a2, CT19, IL-13R, IL13BP

Open Datasheet


Target Information

항목 내용
Target Protein interleukin 13 receptor subunit alpha 2
Target Gene IL13RA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000032973 (74%), Mouse ENSMUSG00000031289 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.