
Atlas Antibodies Anti-IL13RA2 Antibody
상품 한눈에 보기
Human IL13RA2 단백질을 인식하는 토끼 폴리클로날 항체로, interleukin 13 receptor subunit alpha 2를 타깃으로 함. 다양한 응용 분야에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IL13RA2 Antibody
Target: interleukin 13 receptor subunit alpha 2 (IL13RA2)
Type: Polyclonal Antibody against Human IL13RA2
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human IL13RA2.
Validated for use in human samples.
Alternative Gene Names
CD213a2, CT19, IL-13R, IL13BP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | interleukin 13 receptor subunit alpha 2 |
| Target Gene | IL13RA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000032973 (74%), Mouse ENSMUSG00000031289 (73%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IL17C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL17B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL13RA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL16 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.