
Atlas Antibodies Anti-IL13RA1 Antibody
상품 한눈에 보기
인간 IL13RA1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 호스트에서 생산되었으며 Affinity 정제되었습니다. 고글리세롤 PBS 버퍼에 보존되어 안정성이 우수합니다. 인간 반응성이 검증된 고품질 연구용 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IL13RA1 Antibody
Target Information
- Protein: Interleukin 13 receptor, alpha 1
- Gene: IL13RA1
- Alternative Gene Names: CD213a1, IL-13Ra, NR4
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human IL13RA1.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNT
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Rat ENSRNOG00000001713 (88%)
- Mouse ENSMUSG00000017057 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IL16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL13RA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL13RA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IKZF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL10RA Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.