
Atlas Antibodies Anti-IL11RA Antibody
Human IL11RA를 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형식으로 제공. Human에 대한 반응성이 검증됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IL11RA Antibody
Target: Interleukin 11 receptor, alpha (IL11RA)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human IL11RA
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Interleukin 11 receptor, alpha |
| Target Gene | IL11RA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (83%), Rat (80%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
VESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IKZF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL10RA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL11RA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IKZF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IL12RB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|