CacheBy
Atlas Antibodies Anti-IKBKG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IKBKG Antibody

상품 한눈에 보기

Human IKBKG 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. Human, Mouse, Rat 반응성 검증 완료. PrEST 항원을 이용한 Affinity purification 방식으로 고순도 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000426-100 Anti-IKBKG Antibody, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000426-25 Anti-IKBKG Antibody, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IKBKG Antibody

Anti-IKBKG Antibody

Target: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
Type: Polyclonal Antibody against Human IKBKG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human IKBKG protein.


Alternative Gene Names

FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9

Open Datasheet


Target Information

항목 내용
Target Protein inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
Target Gene IKBKG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000060936 91%
Mouse ENSMUSG00000004221 89%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.