CacheBy
Atlas Antibodies Anti-IFT27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IFT27 Antibody

상품 한눈에 보기

Human IFT27 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. WB Orthogonal validation으로 단백질 발현 검증. BBS19/RABL4/RAYL 대체 유전자명과 높은 종간 상동성 보유. Affinity purification 방식으로 높은 특이성과 안정성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018418-100 Anti-IFT27 Antibody, intraflagellar transport 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018418-25 Anti-IFT27 Antibody, intraflagellar transport 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IFT27 Antibody

Anti-IFT27 Antibody

Target: Intraflagellar transport 27 (IFT27)
Type: Polyclonal Antibody against Human IFT27

Orthogonal validation of protein expression using WB, by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody targeting human IFT27 protein.

Alternative Gene Names

  • BBS19
  • RABL4
  • RAYL

Open Datasheet

Target Information

항목 내용
Target Protein Intraflagellar transport 27
Target Gene IFT27
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000006440 80%
Mouse ENSMUSG00000016637 78%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Applications - WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.