
Atlas Antibodies Anti-IFT27 Antibody
상품 한눈에 보기
Human IFT27 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. WB Orthogonal validation으로 단백질 발현 검증. BBS19/RABL4/RAYL 대체 유전자명과 높은 종간 상동성 보유. Affinity purification 방식으로 높은 특이성과 안정성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IFT27 Antibody
Target: Intraflagellar transport 27 (IFT27)
Type: Polyclonal Antibody against Human IFT27
Recommended Applications
Orthogonal validation of protein expression using WB, by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody targeting human IFT27 protein.
Alternative Gene Names
- BBS19
- RABL4
- RAYL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Intraflagellar transport 27 |
| Target Gene | IFT27 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000006440 | 80% |
| Mouse | ENSMUSG00000016637 | 78% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IFT80 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IFT122 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IFT27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IFT20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IFT43 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.