
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IFT27 Antibody
상품 한눈에 보기
Human IFT27 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. WB Orthogonal validation으로 단백질 발현 검증. BBS19/RABL4/RAYL 대체 유전자명과 높은 종간 상동성 보유. Affinity purification 방식으로 높은 특이성과 안정성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018418-100 Anti-IFT27 Antibody, intraflagellar transport 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018418-25 Anti-IFT27 Antibody, intraflagellar transport 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IFT27 Antibody
Anti-IFT27 Antibody
Target: Intraflagellar transport 27 (IFT27)
Type: Polyclonal Antibody against Human IFT27
Recommended Applications
Orthogonal validation of protein expression using WB, by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody targeting human IFT27 protein.
Alternative Gene Names
- BBS19
- RABL4
- RAYL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Intraflagellar transport 27 |
| Target Gene | IFT27 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000006440 | 80% |
| Mouse | ENSMUSG00000016637 | 78% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



