Atlas Antibodies Anti-IDH3B Antibody
상품 한눈에 보기
Human IDH3B 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증된 연구용 시약입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IDH3B Antibody
Target Protein: isocitrate dehydrogenase 3 (NAD+) beta
Product Type: Polyclonal Antibody against Human IDH3B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Immunocytochemistry (ICC)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Alternative Gene Names
- RP46
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | isocitrate dehydrogenase 3 (NAD+) beta |
| Target Gene | IDH3B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (96%), Mouse (96%) |
Antigen Sequence:
VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet: MSDS for Sodium Azide
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.