
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IDH3B Antibody
상품 한눈에 보기
Human IDH3B 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증된 연구용 시약입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054180-100 Anti-IDH3B Antibody, isocitrate dehydrogenase 3 (NAD+) beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054180-25 Anti-IDH3B Antibody, isocitrate dehydrogenase 3 (NAD+) beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IDH3B Antibody
Anti-IDH3B Antibody
Target Protein: isocitrate dehydrogenase 3 (NAD+) beta
Product Type: Polyclonal Antibody against Human IDH3B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Immunocytochemistry (ICC)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Alternative Gene Names
- RP46
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | isocitrate dehydrogenase 3 (NAD+) beta |
| Target Gene | IDH3B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (96%), Mouse (96%) |
Antigen Sequence:
VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet: MSDS for Sodium Azide
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



