
Atlas Antibodies Anti-ICAM1 Antibody
인간 ICAM1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터 기반의 Orthogonal 검증을 통해 높은 신뢰성을 제공합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 보장합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-ICAM1 Antibody
Anti-ICAM1 Antibody
Intercellular Adhesion Molecule 1 (ICAM1)
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human ICAM1
Alternative Gene Names
BB2, CD54
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Intercellular adhesion molecule 1 |
| Target Gene | ICAM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000037405 (55%), Rat ENSRNOG00000020679 (49%) |
Antigen Sequence:
EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



