Atlas Antibodies Anti-ICAM5 Antibody

상품 한눈에 보기

Human ICAM5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 분석에 적합합니다. TLCN/TLN 유전자 대응, Orthogonal 검증 완료. 고순도의 Affinity 정제 방식 적용, 다양한 조직에서 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA008943-100 Anti-ICAM5 Antibody, intercellular adhesion molecule 5, telencephalin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA008943-25 Anti-ICAM5 Antibody, intercellular adhesion molecule 5, telencephalin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ICAM5 Antibody

Anti-ICAM5 Antibody

Target: Intercellular adhesion molecule 5 (Telencephalin)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human ICAM5.

Alternative Gene Names

TLCN, TLN

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Intercellular adhesion molecule 5 (Telencephalin)
Target Gene	ICAM5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	VRSGELGAVIEGLLRVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVVS
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000020694 (74%), Mouse ENSMUSG00000032174 (74%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand