CacheBy
Atlas Antibodies Anti-ICAM3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ICAM3 Antibody

상품 한눈에 보기

인간 ICAM3 단백질을 인식하는 폴리클로날 항체로, 면역세포 간 접착 연구에 적합합니다. 토끼에서 유래한 IgG 항체이며, Affinity Purified 방식으로 정제되었습니다. 면역형광(ICC) 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049820-100 Anti-ICAM3 Antibody, intercellular adhesion molecule 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049820-25 Anti-ICAM3 Antibody, intercellular adhesion molecule 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ICAM3 Antibody

Anti-ICAM3 Antibody

Target: Intercellular adhesion molecule 3 (ICAM3)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ICAM3, produced in rabbit and affinity-purified using the PrEST antigen.

Alternative Gene Names

  • CD50
  • CDW50
  • ICAM-R

Open Datasheet

Target Information

항목 내용
Target Protein Intercellular adhesion molecule 3
Target Gene ICAM3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000010929 (39%), Mouse ENSMUSG00000020712 (37%)

Antigen Sequence:
AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.