CacheBy
Atlas Antibodies Anti-IARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IARS2 Antibody

상품 한눈에 보기

인간 IARS2 단백질을 인식하는 토끼 폴리클로날 항체입니다. WB 검증 완료 및 독립 항체 비교 검증을 통해 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 다양한 연구 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024596-100 Anti-IARS2 Antibody, isoleucyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024596-25 Anti-IARS2 Antibody, isoleucyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IARS2 Antibody

Anti-IARS2 Antibody

Target: isoleucyl-tRNA synthetase 2, mitochondrial
Type: Polyclonal Antibody against Human IARS2


  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against human IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial).


Alternative Gene Names

  • FLJ10326

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein isoleucyl-tRNA synthetase 2, mitochondrial
Target Gene IARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
NVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYV
Verified Species Reactivity Human
Ortholog Identity Mouse ENSMUSG00000026618 (79%), Rat ENSRNOG00000002368 (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.