
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IARS2 Antibody
상품 한눈에 보기
인간 IARS2 단백질을 인식하는 토끼 폴리클로날 항체입니다. WB 검증 완료 및 독립 항체 비교 검증을 통해 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 다양한 연구 응용에 적합합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024596-100 Anti-IARS2 Antibody, isoleucyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024596-25 Anti-IARS2 Antibody, isoleucyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IARS2 Antibody
Anti-IARS2 Antibody
Target: isoleucyl-tRNA synthetase 2, mitochondrial
Type: Polyclonal Antibody against Human IARS2
Recommended Applications
- WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial).
Alternative Gene Names
- FLJ10326
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | isoleucyl-tRNA synthetase 2, mitochondrial |
| Target Gene | IARS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYV |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000026618 (79%), Rat ENSRNOG00000002368 (77%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



