
Atlas Antibodies Anti-HSD3B7 Antibody
인체 HSD3B7 단백질에 대한 고특이성 폴리클로날 항체. IHC 및 ICC 실험에 적합. Rabbit IgG 포맷으로 제공되며, 프레스티지 항원 기반 친화 정제. 인간 반응성 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HSD3B7 Antibody
Target Protein: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human HSD3B7.
Alternative Gene Names
C(27)-3BETA-HSD, SDR11E3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 |
| Target Gene | HSD3B7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000042289) – 85%
- Rat (ENSRNOG00000019080) – 85%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HSF2BP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HSD3B7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HSD3B7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HSDL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HSD17B8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|