Atlas Antibodies Anti-HS3ST3A1 Antibody

상품 한눈에 보기

Human HS3ST3A1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증됨. 사용 전 부드럽게 혼합 권장.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062518-100 Anti-HS3ST3A1 Antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062518-25 Anti-HS3ST3A1 Antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
Supplier: Atlas Antibodies

면역세포화학(ICC) 등 다양한 면역분석 응용에 적합합니다.

Polyclonal antibody against human HS3ST3A1.

항목	내용
Target Protein	heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
Target Gene	HS3ST3A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000047759 (57%) Rat ENSRNOG00000024591 (50%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.