
Atlas Antibodies Anti-HS3ST3A1 Antibody
상품 한눈에 보기
Human HS3ST3A1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증됨. 사용 전 부드럽게 혼합 권장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HS3ST3A1 Antibody
Target Protein: heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC) 등 다양한 면역분석 응용에 적합합니다.
Product Description
Polyclonal antibody against human HS3ST3A1.
Alternative Gene Names
- 30ST3A1
- 3OST3A1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 |
| Target Gene | HS3ST3A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000047759 (57%) Rat ENSRNOG00000024591 (50%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HS3ST3B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HS3ST2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HS3ST3A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HS2ST1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HRASLS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.