
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HS3ST3A1 Antibody
상품 한눈에 보기
Human HS3ST3A1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증됨. 사용 전 부드럽게 혼합 권장.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062518-100 Anti-HS3ST3A1 Antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062518-25 Anti-HS3ST3A1 Antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HS3ST3A1 Antibody
Anti-HS3ST3A1 Antibody
Target Protein: heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC) 등 다양한 면역분석 응용에 적합합니다.
Product Description
Polyclonal antibody against human HS3ST3A1.
Alternative Gene Names
- 30ST3A1
- 3OST3A1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 |
| Target Gene | HS3ST3A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000047759 (57%) Rat ENSRNOG00000024591 (50%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



