Atlas Antibodies Anti-HRCT1 Antibody
| 상품 옵션 정보 | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA067038-100 | - | Atlas Antibodies HPA067038-100 Anti-HRCT1 Antibody, histidine rich carboxyl terminus 1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
| HPA067038-25 | - | Atlas Antibodies HPA067038-25 Anti-HRCT1 Antibody, histidine rich carboxyl terminus 1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | ||
다른 상품 둘러보기
Anti-HRCT1 Antibody
histidine rich carboxyl terminus 1
Recommended Applications
Product Description
Polyclonal Antibody against Human HRCT1
Alternative Gene Names
LGLL338, PRO537, UNQ338
Target Protein
histidine rich carboxyl terminus 1
Target Gene
HRCT1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000071001 (43%)
Rat ENSRNOG00000047935 (30%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|