CacheBy
Atlas Antibodies Anti-HRG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HRG Antibody

상품 한눈에 보기

Human HRG 단백질을 인식하는 토끼 폴리클로날 항체로, histidine-rich glycoprotein 분석에 사용. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 고순도 IgG, PBS/glycerol buffer로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054598-100 Anti-HRG Antibody, histidine-rich glycoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054598-25 Anti-HRG Antibody, histidine-rich glycoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HRG Antibody

Anti-HRG Antibody

Target Information

  • Target Protein: Histidine-rich glycoprotein
  • Target Gene: HRG
  • Alternative Gene Names: HPRG, HRGP

Product Description

Polyclonal antibody against human HRG, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022877 76%
Rat ENSRNOG00000001809 71%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (Sodium Azide)

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.