
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HNRNPA2B1 Antibody
상품 한눈에 보기
Human HNRNPA2B1 단백질을 인식하는 토끼 유래 polyclonal 항체로, IHC와 WB에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 사람, 마우스, 랫트에 반응합니다. 안정한 PBS/glycerol buffer로 보존되어 연구 재현성이 우수합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001666-100 Anti-HNRNPA2B1 Antibody, heterogeneous nuclear ribonucleoprotein A2/B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001666-25 Anti-HNRNPA2B1 Antibody, heterogeneous nuclear ribonucleoprotein A2/B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HNRNPA2B1 Antibody
Anti-HNRNPA2B1 Antibody
Target Information
- Target Protein: heterogeneous nuclear ribonucleoprotein A2/B1
- Target Gene: HNRNPA2B1
- Alternative Gene Names: HNRPA2B1
Product Description
Polyclonal antibody against human HNRNPA2B1, suitable for immunohistochemistry (IHC) and western blot (WB) applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000011175 | 100% |
| Mouse | ENSMUSG00000004980 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



