
Atlas Antibodies Anti-HNRNPA2B1 Antibody
상품 한눈에 보기
Human HNRNPA2B1 단백질을 인식하는 토끼 유래 polyclonal 항체로, IHC와 WB에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 사람, 마우스, 랫트에 반응합니다. 안정한 PBS/glycerol buffer로 보존되어 연구 재현성이 우수합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HNRNPA2B1 Antibody
Target Information
- Target Protein: heterogeneous nuclear ribonucleoprotein A2/B1
- Target Gene: HNRNPA2B1
- Alternative Gene Names: HNRPA2B1
Product Description
Polyclonal antibody against human HNRNPA2B1, suitable for immunohistochemistry (IHC) and western blot (WB) applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000011175 | 100% |
| Mouse | ENSMUSG00000004980 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA2B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA2B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA2B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.