
Atlas Antibodies Anti-HNRNPA0 Antibody
상품 한눈에 보기
인간 HNRNPA0 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간, 생쥐, 랫트에 반응하며 높은 종간 일치율을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HNRNPA0 Antibody
Target Protein: heterogeneous nuclear ribonucleoprotein A0
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation: 비교 항체를 통한 단백질 발현 검증)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human HNRNPA0.
Alternative Gene Names
- hnRNPA0
- HNRPA0
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000007836 | 93% |
| Rat | ENSRNOG00000039876 | 93% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA0 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNRNPA0 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNMT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HNMT Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.