AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HN1L Antibody
상품 한눈에 보기
Human HN1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 고순도 친화 정제 방식으로 제조되었으며, 인간에 높은 특이성을 보입니다. 40% 글리세롤/PBS 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041888-100 Anti-HN1L Antibody, hematological and neurological expressed 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041888-25 Anti-HN1L Antibody, hematological and neurological expressed 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HN1L Antibody
Anti-HN1L Antibody
Target: Hematological and neurological expressed 1-like (HN1L)
Type: Polyclonal Antibody against Human HN1L
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit targeting the human HN1L protein.
Purified by affinity chromatography using the PrEST antigen.
Alternative Gene Names
C16orf34, FLJ13092, KIAA1426, L11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Hematological and neurological expressed 1-like |
| Target Gene | HN1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000024661 (79%) Mouse ENSMUSG00000024165 (74%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.