
Atlas Antibodies Anti-HMG20B Antibody
상품 한눈에 보기
인간 HMG20B 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. 토끼 유래 IgG 형식이며, 프레스티 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 신뢰성 높은 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HMG20B Antibody
Target Protein: High Mobility Group 20B (HMG20B)
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC) 등 다양한 연구용 응용에 권장됩니다.
Product Description
Polyclonal Antibody against Human HMG20B
Alternative Gene Names
BRAF25, BRAF35, HMGX2, HMGXB2, SMARCE1r, SOXL
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
EDRRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTLDFYMARLHGAIERDPAQHEKLIVRIKEILAQVASEH
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000020601 | 93% |
| Mouse | ENSMUSG00000020232 | 93% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HMG20B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HMCN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HMG20B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HMBOX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HMCN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.