
Atlas Antibodies Anti-HLA-DPB1 Antibody
상품 한눈에 보기
인체 HLA-DPB1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 정제된 Rabbit IgG 형식으로 제공되며, Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. 고순도 Affinity 정제 방식으로 제조되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HLA-DPB1 Antibody
Target: major histocompatibility complex, class II, DP beta 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues
- WB (Western Blot)
Product Description
Polyclonal antibody against human HLA-DPB1
Alternative Gene Names
- HLA-DP1B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | major histocompatibility complex, class II, DP beta 1 |
| Target Gene | HLA-DPB1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000032708 | 69% |
| Mouse | ENSMUSG00000073421 | 69% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HLA-DQA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HLA-DOB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HLA-DPB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HLA-DPA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HLA-DMB Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.