
Atlas Antibodies Anti-HIP1R Antibody
상품 한눈에 보기
인간 HIP1R 단백질을 표적으로 하는 폴리클로날 래빗 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체로 인체 반응성이 검증됨. HIP1R 관련 연구에 신뢰성 높은 단백질 검출 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HIP1R Antibody
Target: huntingtin interacting protein 1 related (HIP1R)
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human HIP1R
Alternative Gene Names
FLJ14000, HIP12, HIP3, ILWEQ, KIAA0655
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | huntingtin interacting protein 1 related |
| Target Gene | HIP1R |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000001091 (89%), Mouse ENSMUSG00000000915 (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence:
VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HIPK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HIPK4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HIP1R Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HIP1R Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HIPK3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.