CacheBy
Atlas Antibodies Anti-HGS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HGS Antibody

상품 한눈에 보기

Human HGS 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간 반응성 검증 완료, 마우스·랫과 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004872-100 Anti-HGS Antibody, hepatocyte growth factor-regulated tyrosine kinase substrate 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004872-25 Anti-HGS Antibody, hepatocyte growth factor-regulated tyrosine kinase substrate 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HGS Antibody

Anti-HGS Antibody

Target: hepatocyte growth factor-regulated tyrosine kinase substrate (HGS)
Type: Polyclonal Antibody against Human HGS

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Alternative Gene Names

Hrs, Vps27, ZFYVE8

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein hepatocyte growth factor-regulated tyrosine kinase substrate
Target Gene HGS
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDS

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000025793 89%
Rat ENSRNOG00000036696 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.