Atlas Antibodies Anti-HGS Antibody
상품 한눈에 보기
Human HGS 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간 반응성 검증 완료, 마우스·랫과 높은 상동성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HGS Antibody
Target: hepatocyte growth factor-regulated tyrosine kinase substrate (HGS)
Type: Polyclonal Antibody against Human HGS
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Alternative Gene Names
Hrs, Vps27, ZFYVE8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | hepatocyte growth factor-regulated tyrosine kinase substrate |
| Target Gene | HGS |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000025793 | 89% |
| Rat | ENSRNOG00000036696 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.