
Atlas Antibodies Anti-HENMT1 Antibody
상품 한눈에 보기
Human HENMT1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 재조합 발현 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HENMT1 Antibody
Target: HEN1 methyltransferase homolog 1 (Arabidopsis)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human HENMT1.
Alternative Gene Names
C1orf59, FLJ30525, HEN1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | HEN1 methyltransferase homolog 1 (Arabidopsis) |
| Target Gene | HENMT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000045662 | 68% |
| Rat | ENSRNOG00000042814 | 47% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-HEMK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HEPN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HENMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HEPH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-HEMK1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.