CacheBy
Atlas Antibodies Anti-HDHD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HDHD3 Antibody

상품 한눈에 보기

인간 HDHD3 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 재조합 단백질 발현 검증 완료. Human 종에 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024585-100 Anti-HDHD3 Antibody, haloacid dehalogenase-like hydrolase domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024585-25 Anti-HDHD3 Antibody, haloacid dehalogenase-like hydrolase domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HDHD3 Antibody

Anti-HDHD3 Antibody

Target: haloacid dehalogenase-like hydrolase domain containing 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human HDHD3


Alternative Gene Names

  • C9orf158
  • MGC12904

Open Datasheet


Target Information

항목 내용
Target Protein haloacid dehalogenase-like hydrolase domain containing 3
Target Gene HDHD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000038422 75%
Rat ENSRNOG00000015195 75%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.