
Atlas Antibodies Anti-GRWD1 Antibody
상품 한눈에 보기
인간 GRWD1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 실험에 적합하며 독립 항체 검증을 통해 신뢰성 확보. 토끼 유래 IgG 항체로 PrEST 항원 정제 방식 사용.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRWD1 Antibody
Target Protein: glutamate-rich WD repeat containing 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independent antibody validation)
- Immunocytochemistry (ICC)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human GRWD1.
Alternative Gene Names
GRWD, RRB1, WDR28
Specifications
| 항목 | 내용 |
|---|---|
| Target Gene | GRWD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021058 (89%), Mouse ENSMUSG00000053801 (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (Sodium Azide)
Antigen Sequence
PVTSVEWHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKELHWHPQCPGLLVSTALSGFTIFRTISV제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRXCR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GSC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRWD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRWD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRSF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.