
Atlas Antibodies Anti-GRSF1 Antibody
Human GRSF1 단백질을 표적으로 하는 폴리클로날 Rabbit IgG 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent 검증을 통해 높은 신뢰성 확보. Affinity purification 방식으로 정제되어 높은 특이성과 재현성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRSF1 Antibody
Target: G-rich RNA sequence binding factor 1 (GRSF1)
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Suitable for ICC applications.
Product Description
Polyclonal Antibody against Human GRSF1
Open Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | G-rich RNA sequence binding factor 1 |
| Target Gene | GRSF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (89%), Rat (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRSF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRTP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRSF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRPEL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRPEL2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|