Atlas Antibodies Anti-GRSF1 Antibody

상품 한눈에 보기

Human GRSF1 단백질을 표적으로 하는 폴리클로날 Rabbit IgG 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent 검증을 통해 높은 신뢰성 확보. Affinity purification 방식으로 정제되어 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036984-100 Anti-GRSF1 Antibody, G-rich RNA sequence binding factor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036984-25 Anti-GRSF1 Antibody, G-rich RNA sequence binding factor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GRSF1 Antibody

Anti-GRSF1 Antibody

Target: G-rich RNA sequence binding factor 1 (GRSF1)
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)
Suitable for ICC applications.

Product Description

Polyclonal Antibody against Human GRSF1
Open Datasheet

Specifications

항목	내용
Target Protein	G-rich RNA sequence binding factor 1
Target Gene	GRSF1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN
Verified Species Reactivity	Human
Interspecies Homology	Mouse (89%), Rat (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen as ligand