
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GRPEL1 Antibody
상품 한눈에 보기
인간 GRPEL1 단백질에 대한 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원 기반 친화 정제 방식으로 제조되었으며, 인간·마우스·랫트 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼로 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036647-100 Anti-GRPEL1 Antibody, GrpE-like 1, mitochondrial (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036647-25 Anti-GRPEL1 Antibody, GrpE-like 1, mitochondrial (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GRPEL1 Antibody
Anti-GRPEL1 Antibody
Target: GrpE-like 1, mitochondrial (E. coli)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human GRPEL1
Alternative Gene Names
FLJ25609, HMGE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GrpE-like 1, mitochondrial (E. coli) |
| Target Gene | GRPEL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000029198 (89%), Rat ENSRNOG00000006593 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



