Atlas Antibodies Anti-GRM6 Antibody

상품 한눈에 보기

Human GRM6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. GRM6는 glutamate receptor, metabotropic 6 단백질로 알려져 있으며, 높은 종간 보존성을 가짐. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014511-100 Anti-GRM6 Antibody, glutamate receptor, metabotropic 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014511-25 Anti-GRM6 Antibody, glutamate receptor, metabotropic 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GRM6 Antibody

Anti-GRM6 Antibody

Target: Glutamate receptor, metabotropic 6 (GRM6)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human GRM6.
Recognizes the glutamate receptor, metabotropic 6 protein.

Alternative Gene Names

CSNB1B, GPRC1F, mGlu6, MGLUR6

Recommended Applications

Immunohistochemistry (IHC)

Target Information

Target Protein: Glutamate receptor, metabotropic 6
Target Gene: GRM6
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000000617): 95%
Rat (ENSRNOG00000000233): 92%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand