CacheBy
Atlas Antibodies Anti-GRK5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRK5 Antibody

상품 한눈에 보기

Human GRK5 단백질을 인식하는 Rabbit Polyclonal 항체로, G protein-coupled receptor kinase 5 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, 다양한 종 간 높은 서열 일치를 보입니다. ICC 등 연구용에 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046838-100 Anti-GRK5 Antibody, G protein-coupled receptor kinase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046838-25 Anti-GRK5 Antibody, G protein-coupled receptor kinase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRK5 Antibody

Anti-GRK5 Antibody

Target: G protein-coupled receptor kinase 5 (GRK5)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GRK5.


Alternative Gene Names

  • GPRK5

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein G protein-coupled receptor kinase 5
Target Gene GRK5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL
Verified Species Reactivity Human
Interspecies Identity Mouse (91%), Rat (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.