
Atlas Antibodies Anti-WNT8A Antibody
Human WNT8A 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 검증 완료. Recombinant expression 기반 검증으로 높은 특이성과 재현성 제공. Rabbit 유래 IgG, PrEST 항원 친화 정제 방식 적용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WNT8A Antibody
Target: wingless-type MMTV integration site family, member 8A
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human WNT8A.
Alternative Gene Names
- WNT8D
Antigen Information
Antigen Sequence (PrEST antigen):
MGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNT
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000020157 | 81% |
| Mouse | ENSMUSG00000012282 | 77% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WNT8B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WNT7A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WNT8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WNT2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WNT2B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|