
Atlas Antibodies Anti-WFDC8 Antibody
인간 WFDC8 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등에서 단백질 발현을 RNA-seq 데이터와 비교 검증 가능. PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WFDC8 Antibody
WAP four-disulfide core domain 8
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human WFDC8
Alternative Gene Names
C20orf170, dJ461P17.1, WAP8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WAP four-disulfide core domain 8 |
| Target Gene | WFDC8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KHKPGLCPKERLTCTTELPDSCNTDFDCKEYQKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNA |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000070533 (55%), Rat ENSRNOG00000014771 (48%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WFDC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WFDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WFDC8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WFDC8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDYHV1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|