
Atlas Antibodies Anti-WDR72 Antibody
상품 한눈에 보기
인간 WDR72 단백질을 인식하는 토끼 폴리클로날 항체. ICC 등 다양한 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 기반 완충액에 보존 처리됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WDR72 Antibody
Target: WD repeat domain 72 (WDR72)
Type: Polyclonal Antibody against Human WDR72
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human WD repeat domain 72 (WDR72).
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- FLJ38736
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat domain 72 |
| Target Gene | WDR72 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000044976 (84%)
- Rat ENSRNOG00000054889 (84%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WDR76 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR77 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR72 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR76 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR75 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.