CacheBy
Atlas Antibodies Anti-WDR72 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDR72 Antibody

상품 한눈에 보기

인간 WDR72 단백질을 인식하는 토끼 폴리클로날 항체. ICC 등 다양한 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 기반 완충액에 보존 처리됨.

카탈로그번호
HPA059819-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059819-100 Anti-WDR72 Antibody, WD repeat domain 72 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059819-25 Anti-WDR72 Antibody, WD repeat domain 72 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDR72 Antibody

Anti-WDR72 Antibody

Target: WD repeat domain 72 (WDR72)
Type: Polyclonal Antibody against Human WDR72
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human WD repeat domain 72 (WDR72).
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ38736

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein WD repeat domain 72
Target Gene WDR72
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000044976 (84%)
  • Rat ENSRNOG00000054889 (84%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.