
Atlas Antibodies Anti-WDR62 Antibody
상품 한눈에 보기
인간 WDR62 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반의 정교한 단백질 발현 검증 수행. 고순도의 친화정제 방식으로 제작되어 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WDR62 Antibody
WD repeat domain 62
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human WDR62.
Alternative Gene Names
C19orf14, DKFZP434J046, FLJ33298, MCPH2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat domain 62 |
| Target Gene | WDR62 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YVSTPSEIHSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRLLGDDDVADGSAFHAKRSYQPHGRWAERAGQEPLKTILD |
Species Reactivity
Verified Species: Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000037020 (93%)
- Rat ENSRNOG00000049708 (90%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WDR63 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR64 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR62 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR61 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WDR60 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.