AI 생성

1 / 2

Atlas Antibodies Anti-WARS2 Antibody

상품 한눈에 보기

인간 WARS2 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG 형식으로 제작되어 높은 특이성과 재현성을 제공. 면역세포화학(ICC) 등 다양한 응용에 적합. PrEST 항원으로 정제되어 신뢰성 높은 결과를 보장.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069692-100 Anti-WARS2 Antibody, tryptophanyl tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069692-25 Anti-WARS2 Antibody, tryptophanyl tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: tryptophanyl tRNA synthetase 2, mitochondrial
Target Gene: WARS2
Alternative Gene Name: TrpRS

면역세포화학 (ICC)

Polyclonal Antibody against Human WARS2

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.