CacheBy
Atlas Antibodies Anti-VWCE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VWCE Antibody

상품 한눈에 보기

Human VWCE 단백질을 표적으로 하는 Rabbit Polyclonal 항체. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA043921-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043921-100 Anti-VWCE Antibody, von Willebrand factor C and EGF domains 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043921-25 Anti-VWCE Antibody, von Willebrand factor C and EGF domains 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VWCE Antibody

Anti-VWCE Antibody

Target Information

  • Target Protein: von Willebrand factor C and EGF domains
  • Target Gene: VWCE
  • Alternative Gene Names: FLJ32009, URG11, VWC1

Product Description

Polyclonal Antibody against Human VWCE.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000043789 (83%)
  • Rat ENSRNOG00000060269 (81%)

면역조직화학(IHC) 등 다양한 연구용 응용에 적합.

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide 포함
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.