
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VSIG1 Antibody
상품 한눈에 보기
인간 VSIG1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 확인되었으며, 정제된 고품질 연구용 항체입니다.
- 카탈로그번호
- HPA036310-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036310-100 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036310-25 Anti-VSIG1 Antibody, V-set and immunoglobulin domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VSIG1 Antibody
Anti-VSIG1 Antibody
V-set and immunoglobulin domain containing 1
Recommended Applications
IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human VSIG1
Alternative Gene Names
- MGC44287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | V-set and immunoglobulin domain containing 1 |
| Target Gene | VSIG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000054219 (82%), Mouse ENSMUSG00000031430 (79%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



