CacheBy
Atlas Antibodies Anti-VPS52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS52 Antibody

상품 한눈에 보기

휴먼 VPS52 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. 면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048128-100 Anti-VPS52 Antibody, vacuolar protein sorting 52 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048128-25 Anti-VPS52 Antibody, vacuolar protein sorting 52 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS52 Antibody

Anti-VPS52 Antibody

Target: vacuolar protein sorting 52 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human VPS52 protein.


Alternative Gene Names

  • ARE1
  • SACM2L

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein vacuolar protein sorting 52 homolog (S. cerevisiae)
Target Gene VPS52
Verified Species Reactivity Human
Interspecies Identity Mouse (100%), Rat (99%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAM

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.