CacheBy
Atlas Antibodies Anti-VPS35 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS35 Antibody

상품 한눈에 보기

Human VPS35 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Genetic validation으로 신뢰성 확보. Rabbit 유래 IgG, Affinity purified 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040802-100 Anti-VPS35 Antibody, vacuolar protein sorting 35 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040802-25 Anti-VPS35 Antibody, vacuolar protein sorting 35 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS35 Antibody

Anti-VPS35 Antibody

Target: vacuolar protein sorting 35 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Genetic validation): Genetic validation in Western blot by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human VPS35.


Alternative Gene Names

FLJ10752, MEM3, PARK17


Target Information

항목 내용
Target Protein vacuolar protein sorting 35 homolog (S. cerevisiae)
Target Gene VPS35
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000017612 (98%), Mouse ENSMUSG00000031696 (97%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

SCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDD

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Genetic
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.