
Atlas Antibodies Anti-VPS35 Antibody
상품 한눈에 보기
Human VPS35 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Genetic validation으로 신뢰성 확보. Rabbit 유래 IgG, Affinity purified 제품.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VPS35 Antibody
Target: vacuolar protein sorting 35 homolog (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Genetic validation): Genetic validation in Western blot by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human VPS35.
Alternative Gene Names
FLJ10752, MEM3, PARK17
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | vacuolar protein sorting 35 homolog (S. cerevisiae) |
| Target Gene | VPS35 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000017612 (98%), Mouse ENSMUSG00000031696 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
SCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDDNotes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-VPS37A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS33B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS35 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS28 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VPS26B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.