CacheBy
Atlas Antibodies Anti-VILL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VILL Antibody

상품 한눈에 보기

Human VILL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반의 오쏘고날 밸리데이션을 통해 검증됨. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 완충액에 보존됨. 다양한 조직 발현 비교 연구에 적합.

카탈로그번호
HPA035675-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035675-100 Anti-VILL Antibody, villin-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035675-25 Anti-VILL Antibody, villin-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VILL Antibody

Anti-VILL Antibody

Target: villin-like (VILL)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human VILL.

Open Datasheet


Target Information

항목 내용
Target Protein villin-like
Target Gene VILL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IGWFFTWDPYKWTSHPSHKEVVDGSPAAASTISEITAEVNNLRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSAGSRTSSSV
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000011446 (48%), Mouse ENSMUSG00000038775 (45%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.