CacheBy
Atlas Antibodies Anti-VASH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VASH1 Antibody

상품 한눈에 보기

인간 VASH1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합합니다. 토끼 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 확인되었으며, 높은 종간 항원 서열 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000653-100 Anti-VASH1 Antibody, vasohibin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000653-25 Anti-VASH1 Antibody, vasohibin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VASH1 Antibody

Anti-VASH1 Antibody

Target Protein: vasohibin 1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against Human VASH1.

Alternative Gene Names

  • KIAA1036

Open Datasheet (PDF)

Antigen Information

Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:

GALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021256 96%
Rat ENSRNOG00000010457 96%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.